Lineage for d2fuja1 (2fuj A:5-122)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2550606Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 2550654Protein Hypothetical protein XCC1147 [143146] (1 species)
  7. 2550655Species Xanthomonas campestris pv. campestris [TaxId:340] [143147] (1 PDB entry)
    Uniprot Q8PBH4 5-122
  8. 2550656Domain d2fuja1: 2fuj A:5-122 [134175]

Details for d2fuja1

PDB Entry: 2fuj (more details), 1.7 Å

PDB Description: A putative acyl-CoA thioesterase from Xanthomonas campestris (XC229)
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d2fuja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fuja1 d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {Xanthomonas campestris pv. campestris [TaxId: 340]}
kilarvpisvrwrdmdsmghvnnakyisyleearvrwmlgvegvamtdriapvvaatnvn
ykrplvwpndilvelfverlgsssvtighrildqkdegvlysdgnvvvvwidtqtgks

SCOPe Domain Coordinates for d2fuja1:

Click to download the PDB-style file with coordinates for d2fuja1.
(The format of our PDB-style files is described here.)

Timeline for d2fuja1: