Lineage for d2fuha1 (2fuh A:2-147)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1406945Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1406946Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1406947Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1406955Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1406991Species Human (Homo sapiens), E2 D3 [TaxId:9606] [143054] (4 PDB entries)
    Uniprot P61077 1-147
  8. 1406995Domain d2fuha1: 2fuh A:2-147 [134173]
    Other proteins in same PDB: d2fuhb1
    automatically matched to 1X23 A:1-147

Details for d2fuha1

PDB Entry: 2fuh (more details)

PDB Description: Solution Structure of the UbcH5c/Ub Non-covalent Complex
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 D3

SCOPe Domain Sequences for d2fuha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fuha1 d.20.1.1 (A:2-147) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 D3 [TaxId: 9606]}
alkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplvp
eiariyktdrdkynrisrewtqkyam

SCOPe Domain Coordinates for d2fuha1:

Click to download the PDB-style file with coordinates for d2fuha1.
(The format of our PDB-style files is described here.)

Timeline for d2fuha1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fuhb1