SCOP 1.75: Domain d2fuha1: 2fuh A:2-147

Lineage for d2fuha1 (2fuh A:2-147)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (4 families)

5. Family d.20.1.1: UBC-related [54496] (6 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (32 species)

7. Species Human (Homo sapiens), E2 D3 [TaxId:9606] [143054] (2 PDB entries)
   Uniprot P61077 1-147

8. Domain d2fuha1: 2fuh A:2-147 [134173]
   Other proteins in same PDB: d2fuhb1
   automatically matched to 1X23 A:1-147

Details for d2fuha1

PDB Entry: 2fuh

PDB Description: solution structure of the ubch5c/ub non-covalent complex

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 D3

SCOP Domain Sequences for d2fuha1:

Sequence; same for both SEQRES and ATOM records:

>d2fuha1 d.20.1.1 (A:2-147) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 D3 [TaxId: 9606]}
alkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplvp
eiariyktdrdkynrisrewtqkyam

Timeline for d2fuha1:

• d2fuha1 first appeared in SCOP 1.73
  
• d2fuha1 appears in SCOPe 2.01
  
• d2fuha1 appears in the current release, SCOPe 2.08, called d2fuha_