Lineage for d2fugs3 (2fug S:250-333)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1404193Superfamily d.15.13: Nqo1 middle domain-like [142984] (1 family) (S)
    possibly evolved from 2Fe-2S ferredoxins; contains no iron-sulfur cluster
  5. 1404194Family d.15.13.1: Nqo1 middle domain-like [142985] (1 protein)
    C-terminal part of Pfam PF01512
  6. 1404195Protein NADH-quinone oxidoreductase chain 1, Nqo1 [142986] (1 species)
  7. 1404196Species Thermus thermophilus [TaxId:274] [142987] (1 PDB entry)
    Uniprot Q56222 250-333
  8. 1404200Domain d2fugs3: 2fug S:250-333 [134162]
    Other proteins in same PDB: d2fug11, d2fug12, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1
    automatically matched to 2FUG 1:250-333
    complexed with fes, fmn, sf4

Details for d2fugs3

PDB Entry: 2fug (more details), 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
PDB Compounds: (S:) NADH-quinone oxidoreductase chain 1

SCOPe Domain Sequences for d2fugs3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fugs3 d.15.13.1 (S:250-333) NADH-quinone oxidoreductase chain 1, Nqo1 {Thermus thermophilus [TaxId: 274]}
klyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstpplpfteevldt
pmsyehlqakgsmlgtggvilipe

SCOPe Domain Coordinates for d2fugs3:

Click to download the PDB-style file with coordinates for d2fugs3.
(The format of our PDB-style files is described here.)

Timeline for d2fugs3:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1