Lineage for d2fugl4 (2fug L:96-246)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1203811Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 1203940Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 1204005Protein NADH-quinone oxidoreductase chain 3, Nqo3, domain 2 [143254] (1 species)
  7. 1204006Species Thermus thermophilus [TaxId:274] [143255] (1 PDB entry)
    Uniprot Q56223 96-246
  8. 1204009Domain d2fugl4: 2fug L:96-246 [134154]
    Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1
    automatically matched to 2FUG 3:96-246
    complexed with fes, fmn, sf4

Details for d2fugl4

PDB Entry: 2fug (more details), 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
PDB Compounds: (L:) NADH-quinone oxidoreductase chain 3

SCOPe Domain Sequences for d2fugl4:

Sequence, based on SEQRES records: (download)

>d2fugl4 d.58.1.5 (L:96-246) NADH-quinone oxidoreductase chain 3, Nqo3, domain 2 {Thermus thermophilus [TaxId: 274]}
lsdvvreaqagmveftllnhpldcptcdkggacelqdrtveyglyekyyqkgplelpvyt
rfeftrrhvdkhhplspfvildrercihckrcvryfeevpgdevldfiergvhtfigtmd
fglpsgfsgnitdicpvgalldltarfrarn

Sequence, based on observed residues (ATOM records): (download)

>d2fugl4 d.58.1.5 (L:96-246) NADH-quinone oxidoreductase chain 3, Nqo3, domain 2 {Thermus thermophilus [TaxId: 274]}
lsdvvreaqagmveftllnhpldcptcdkggacelqdrtveyglyeklpvytrfeftrrh
vdkhhplspfvildrercihckrcvryfeevpgdevldfiergvhtfigtmdfglpsgfs
gnitdicpvgalldltarfrarn

SCOPe Domain Coordinates for d2fugl4:

Click to download the PDB-style file with coordinates for d2fugl4.
(The format of our PDB-style files is described here.)

Timeline for d2fugl4:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1