SCOPe 2.02: Domain d2fugl3: 2fug L:1-95

Lineage for d2fugl3 (2fug L:1-95)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (13 proteins)

6. Protein Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain [142982] (1 species)

7. Species Thermus thermophilus [TaxId:274] [142983] (1 PDB entry)
   Uniprot Q56223 1-95

8. Domain d2fugl3: 2fug L:1-95 [134153]
   Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1
   automatically matched to 2FUG 3:1-95
   complexed with fes, fmn, sf4

Details for d2fugl3

PDB Entry: 2fug, 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus

PDB Compounds: (L:) NADH-quinone oxidoreductase chain 3

SCOPe Domain Sequences for d2fugl3:

Sequence, based on SEQRES records:

>d2fugl3 d.15.4.2 (L:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]}
mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpkkgpd
gkpllnekgepeiqwqpklaascvtavadgmvvdt

Sequence, based on observed residues (ATOM records):

>d2fugl3 d.15.4.2 (L:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]}
mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvrigliqwqpk
laascvtavadgmvvdt

Timeline for d2fugl3:

• d2fugl3 first appeared in SCOP 1.73
  
• d2fugl3 appears in SCOPe 2.01
  
• d2fugl3 appears in SCOPe 2.03
  
• d2fugl3 appears in the current release, SCOPe 2.08