![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.21: NQO2-like [142405] (2 proteins) complex I 24 kDa subunit; contains 2Fe-2S cluster in the active site; includes extra N-terminal four-helical bundle automatically mapped to Pfam PF01257 |
![]() | Protein NADH-quinone oxidoreductase chain 2, NQO2 [142406] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [142407] (1 PDB entry) Uniprot Q56221 2-179 |
![]() | Domain d2fugk1: 2fug K:3-180 [134150] Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1 automatically matched to 2FUG 2:3-180 complexed with fes, fmn, sf4 |
PDB Entry: 2fug (more details), 3.3 Å
SCOPe Domain Sequences for d2fugk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fugk1 c.47.1.21 (K:3-180) NADH-quinone oxidoreductase chain 2, NQO2 {Thermus thermophilus [TaxId: 274]} ffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptevmg vasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvqkv eclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve
Timeline for d2fugk1:
![]() Domains from other chains: (mouse over for more information) d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1 |