Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.13: Nqo1 middle domain-like [142984] (2 families) possibly evolved from 2Fe-2S ferredoxins; contains no iron-sulfur cluster |
Family d.15.13.1: Nqo1 middle domain-like [142985] (1 protein) C-terminal part of Pfam PF01512 |
Protein NADH-quinone oxidoreductase chain 1, Nqo1 [142986] (1 species) |
Species Thermus thermophilus [TaxId:274] [142987] (1 PDB entry) Uniprot Q56222 250-333 |
Domain d2fugj3: 2fug J:250-333 [134149] Other proteins in same PDB: d2fug11, d2fug12, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1 automatically matched to 2FUG 1:250-333 complexed with fes, fmn, sf4 |
PDB Entry: 2fug (more details), 3.3 Å
SCOPe Domain Sequences for d2fugj3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fugj3 d.15.13.1 (J:250-333) NADH-quinone oxidoreductase chain 1, Nqo1 {Thermus thermophilus [TaxId: 274]} klyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstpplpfteevldt pmsyehlqakgsmlgtggvilipe
Timeline for d2fugj3:
View in 3D Domains from other chains: (mouse over for more information) d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1 |