| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) ![]() |
| Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
| Protein NADH-quinone oxidoreductase chain 9, Nqo9 [143252] (1 species) |
| Species Thermus thermophilus [TaxId:274] [143253] (1 PDB entry) Uniprot Q56224 26-179 |
| Domain d2fugg1: 2fug G:26-179 [134145] Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugz1 automatically matched to 2FUG 9:26-179 complexed with fes, fmn, sf4 |
PDB Entry: 2fug (more details), 3.3 Å
SCOPe Domain Sequences for d2fugg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fugg1 d.58.1.5 (G:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]}
ypdapvalkprfhgrhvltrhpnglekcigcslcaaacpayaiyvepaendpenpvsage
ryakvyeinmlrcifcglceeacptgaivlgydfemadyeysdlvygkedmlvdvvgtkp
qrreakrtgkpvkvgyvvpyvrpelegfkapteg
Timeline for d2fugg1:
View in 3DDomains from other chains: (mouse over for more information) d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1 |