Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.142: Nqo1 FMN-binding domain-like [142018] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.142.1: Nqo1 FMN-binding domain-like [142019] (1 family) |
Family c.142.1.1: Nqo1 FMN-binding domain-like [142020] (2 proteins) N-terminal part of Pfam PF01512 |
Protein NADH-quinone oxidoreductase chain 1, Nqo1 [142021] (1 species) |
Species Thermus thermophilus [TaxId:274] [142022] (1 PDB entry) Uniprot Q56222 7-249 |
Domain d2fuga2: 2fug A:7-249 [134135] Other proteins in same PDB: d2fug11, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1 automatically matched to 2FUG 1:7-249 complexed with fes, fmn, sf4 |
PDB Entry: 2fug (more details), 3.3 Å
SCOPe Domain Sequences for d2fuga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fuga2 c.142.1.1 (A:7-249) NADH-quinone oxidoreductase chain 1, Nqo1 {Thermus thermophilus [TaxId: 274]} sgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrsglrgrg gagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmilagyair atvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagayicgeet almnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaqmgteqs kgm
Timeline for d2fuga2:
View in 3D Domains from other chains: (mouse over for more information) d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1 |