Lineage for d2fug91 (2fug 9:26-179)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1203811Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 1203940Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 1204011Protein NADH-quinone oxidoreductase chain 9, Nqo9 [143252] (1 species)
  7. 1204012Species Thermus thermophilus [TaxId:274] [143253] (1 PDB entry)
    Uniprot Q56224 26-179
  8. 1204013Domain d2fug91: 2fug 9:26-179 [134133]
    Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugz1
    complexed with fes, fmn, sf4

Details for d2fug91

PDB Entry: 2fug (more details), 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
PDB Compounds: (9:) NADH-quinone oxidoreductase chain 9

SCOPe Domain Sequences for d2fug91:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]}
ypdapvalkprfhgrhvltrhpnglekcigcslcaaacpayaiyvepaendpenpvsage
ryakvyeinmlrcifcglceeacptgaivlgydfemadyeysdlvygkedmlvdvvgtkp
qrreakrtgkpvkvgyvvpyvrpelegfkapteg

SCOPe Domain Coordinates for d2fug91:

Click to download the PDB-style file with coordinates for d2fug91.
(The format of our PDB-style files is described here.)

Timeline for d2fug91:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1