SCOPe 2.02: Domain d2fug71: 2fug 7:3-129

Lineage for d2fug71 (2fug 7:3-129)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
   alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet

4. Superfamily d.82.2: Frataxin/Nqo15-like [55387] (2 families)

5. Family d.82.2.2: Nqo15-like [143572] (1 protein)
   overall structural similarity to the frataxin-like family

6. Protein NADH-quinone oxidoreductase subunit 15, Nqo15 [143573] (1 species)

7. Species Thermus thermophilus [TaxId:274] [143574] (1 PDB entry)
   Uniprot Q5SKZ7 3-129

8. Domain d2fug71: 2fug 7:3-129 [134132]
   Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1
   complexed with fes, fmn, sf4

Details for d2fug71

PDB Entry: 2fug, 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus

PDB Compounds: (7:) conserved hypothetical protein

SCOPe Domain Sequences for d2fug71:

Sequence; same for both SEQRES and ATOM records:

>d2fug71 d.82.2.2 (7:3-129) NADH-quinone oxidoreductase subunit 15, Nqo15 {Thermus thermophilus [TaxId: 274]}
asserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtaslsdg
lgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffaladra
realafa

Timeline for d2fug71:

• d2fug71 first appeared in SCOP 1.73
  
• d2fug71 appears in SCOPe 2.01
  
• d2fug71 appears in SCOPe 2.03
  
• d2fug71 appears in the current release, SCOPe 2.08