Lineage for d2fug71 (2fug 7:3-129)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1033660Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 1033687Superfamily d.82.2: Frataxin/Nqo15-like [55387] (2 families) (S)
  5. 1033719Family d.82.2.2: Nqo15-like [143572] (1 protein)
    overall structural similarity to the frataxin-like family
  6. 1033720Protein NADH-quinone oxidoreductase subunit 15, Nqo15 [143573] (1 species)
  7. 1033721Species Thermus thermophilus [TaxId:274] [143574] (1 PDB entry)
    Uniprot Q5SKZ7 3-129
  8. 1033722Domain d2fug71: 2fug 7:3-129 [134132]
    Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1
    complexed with fes, fmn, sf4

Details for d2fug71

PDB Entry: 2fug (more details), 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
PDB Compounds: (7:) conserved hypothetical protein

SCOPe Domain Sequences for d2fug71:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fug71 d.82.2.2 (7:3-129) NADH-quinone oxidoreductase subunit 15, Nqo15 {Thermus thermophilus [TaxId: 274]}
asserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtaslsdg
lgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffaladra
realafa

SCOPe Domain Coordinates for d2fug71:

Click to download the PDB-style file with coordinates for d2fug71.
(The format of our PDB-style files is described here.)

Timeline for d2fug71:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1