Lineage for d2fug51 (2fug 5:1-196)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1053252Fold d.307: Nqo5-like [143242] (1 superfamily)
    core: alpha-beta(2)-alpha-beta(3); 2 layers, a/b; mixed beta-sheet, order 12534, strands 2 and 5 are parallel
  4. 1053253Superfamily d.307.1: Nqo5-like [143243] (1 family) (S)
  5. 1053254Family d.307.1.1: Nqo5-like [143244] (1 protein)
    Globular region is covered by PfamB PB121908 from N-end and then by PfamB PB000646; contains extra C-terminal unstructured region, corresponding to Pfam PF00329
  6. 1053255Protein NADH-quinone oxidoreductase chain 5, Nqo5 [143245] (1 species)
  7. 1053256Species Thermus thermophilus [TaxId:274] [143246] (1 PDB entry)
    Uniprot Q56219 1-196
  8. 1053257Domain d2fug51: 2fug 5:1-196 [134130]
    Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugx1, d2fugy1, d2fugz1
    complexed with fes, fmn, sf4

Details for d2fug51

PDB Entry: 2fug (more details), 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
PDB Compounds: (5:) NADH-quinone oxidoreductase chain 5

SCOPe Domain Sequences for d2fug51:

Sequence, based on SEQRES records: (download)

>d2fug51 d.307.1.1 (5:1-196) NADH-quinone oxidoreductase chain 5, Nqo5 {Thermus thermophilus [TaxId: 274]}
mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd
lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg
ltfykggsrkgyrslw

Sequence, based on observed residues (ATOM records): (download)

>d2fug51 d.307.1.1 (5:1-196) NADH-quinone oxidoreductase chain 5, Nqo5 {Thermus thermophilus [TaxId: 274]}
mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdnflerevydlfgiv
feghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpgltfyk
ggsrkgyrslw

SCOPe Domain Coordinates for d2fug51:

Click to download the PDB-style file with coordinates for d2fug51.
(The format of our PDB-style files is described here.)

Timeline for d2fug51:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1