Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
Protein Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain [142982] (1 species) |
Species Thermus thermophilus [TaxId:274] [142983] (1 PDB entry) Uniprot Q56223 1-95 |
Domain d2fug33: 2fug 3:1-95 [134127] Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1 complexed with fes, fmn, sf4 |
PDB Entry: 2fug (more details), 3.3 Å
SCOPe Domain Sequences for d2fug33:
Sequence, based on SEQRES records: (download)
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpkkgpd gkpllnekgepeiqwqpklaascvtavadgmvvdt
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvrigliqwqpk laascvtavadgmvvdt
Timeline for d2fug33:
View in 3D Domains from other chains: (mouse over for more information) d2fug11, d2fug12, d2fug13, d2fug21, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1 |