Class b: All beta proteins [48724] (176 folds) |
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) |
Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins) molybdopterine enzyme |
Protein NADH-quinone oxidoreductase chain 3, Nqo3, C-terminal domain [141393] (1 species) topoisomer of the common fold, lacking the second psi loop |
Species Thermus thermophilus [TaxId:274] [141394] (1 PDB entry) Uniprot Q56223 686-767 |
Domain d2fug31: 2fug 3:686-767 [134125] Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug21, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1 complexed with fes, fmn, sf4 |
PDB Entry: 2fug (more details), 3.3 Å
SCOPe Domain Sequences for d2fug31:
Sequence, based on SEQRES records: (download)
>d2fug31 b.52.2.2 (3:686-767) NADH-quinone oxidoreductase chain 3, Nqo3, C-terminal domain {Thermus thermophilus [TaxId: 274]} kerkgafylrptmwkahqavgkaqeaaraelwahpetaraealpegaqvavetpfgrvea rvvhredvpkghlylsalgpaa
>d2fug31 b.52.2.2 (3:686-767) NADH-quinone oxidoreductase chain 3, Nqo3, C-terminal domain {Thermus thermophilus [TaxId: 274]} kerkgafylrptmwkahqavgkaqeaarawahpetaraealpegaqvavetpfgrvearv vhredvpkghlylsalgpaa
Timeline for d2fug31:
View in 3D Domains from other chains: (mouse over for more information) d2fug11, d2fug12, d2fug13, d2fug21, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1 |