Lineage for d2fug31 (2fug 3:686-767)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 956889Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 956931Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 956955Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
    molybdopterine enzyme
  6. 956992Protein NADH-quinone oxidoreductase chain 3, Nqo3, C-terminal domain [141393] (1 species)
    topoisomer of the common fold, lacking the second psi loop
  7. 956993Species Thermus thermophilus [TaxId:274] [141394] (1 PDB entry)
    Uniprot Q56223 686-767
  8. 956994Domain d2fug31: 2fug 3:686-767 [134125]
    Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug21, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1
    complexed with fes, fmn, sf4

Details for d2fug31

PDB Entry: 2fug (more details), 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
PDB Compounds: (3:) NADH-quinone oxidoreductase chain 3

SCOPe Domain Sequences for d2fug31:

Sequence, based on SEQRES records: (download)

>d2fug31 b.52.2.2 (3:686-767) NADH-quinone oxidoreductase chain 3, Nqo3, C-terminal domain {Thermus thermophilus [TaxId: 274]}
kerkgafylrptmwkahqavgkaqeaaraelwahpetaraealpegaqvavetpfgrvea
rvvhredvpkghlylsalgpaa

Sequence, based on observed residues (ATOM records): (download)

>d2fug31 b.52.2.2 (3:686-767) NADH-quinone oxidoreductase chain 3, Nqo3, C-terminal domain {Thermus thermophilus [TaxId: 274]}
kerkgafylrptmwkahqavgkaqeaarawahpetaraealpegaqvavetpfgrvearv
vhredvpkghlylsalgpaa

SCOPe Domain Coordinates for d2fug31:

Click to download the PDB-style file with coordinates for d2fug31.
(The format of our PDB-style files is described here.)

Timeline for d2fug31:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fug11, d2fug12, d2fug13, d2fug21, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1