SCOPe 2.01: Domain d2fuea_: 2fue A:

Lineage for d2fuea_ (2fue A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
   contains an alpha+beta subdomain inserted into a new site after strand 3

6. Protein automated matches [190498] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187723] (1 PDB entry)

8. Domain d2fuea_: 2fue A: [134119]
   automated match to d2fuca1
   complexed with m1p, mg

Details for d2fuea_

PDB Entry: 2fue, 1.75 Å

PDB Description: human alpha-phosphomannomutase 1 with d-mannose 1-phosphate and mg2+ cofactor bound

PDB Compounds: (A:) Phosphomannomutase 1

SCOPe Domain Sequences for d2fuea_:

Sequence; same for both SEQRES and ATOM records:

>d2fuea_ c.108.1.10 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rvlclfdvdgtltparqkidpevaaflqklrsrvqigvvggsdyckiaeqlgdgdeviek
fdyvfaengtvqykhgrllskqtiqnhlgeellqdlinfclsymallrlpkkrgtfiefr
ngmlnispigrsctleeriefseldkkekirekfvealktefagkglrfsrggmisfdvf
pegwdkrycldsldqdsfdtihffgnetspggndfeifadprtvghsvvspqdtvqrcre
iffpet

Timeline for d2fuea_:

• d2fuea_ first appeared in SCOP 1.73, called d2fuea1
  
• d2fuea_ was called d2fuea1 in SCOP 1.75
  
• d2fuea_ appears in SCOPe 2.02
  
• d2fuea_ appears in the current release, SCOPe 2.08