Lineage for d2fuea_ (2fue A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2919946Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 2920018Protein automated matches [190498] (5 species)
    not a true protein
  7. 2920022Species Human (Homo sapiens) [TaxId:9606] [187723] (2 PDB entries)
  8. 2920023Domain d2fuea_: 2fue A: [134119]
    automated match to d2fuca1
    complexed with m1p, mg

Details for d2fuea_

PDB Entry: 2fue (more details), 1.75 Å

PDB Description: human alpha-phosphomannomutase 1 with d-mannose 1-phosphate and mg2+ cofactor bound
PDB Compounds: (A:) Phosphomannomutase 1

SCOPe Domain Sequences for d2fuea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fuea_ c.108.1.10 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rvlclfdvdgtltparqkidpevaaflqklrsrvqigvvggsdyckiaeqlgdgdeviek
fdyvfaengtvqykhgrllskqtiqnhlgeellqdlinfclsymallrlpkkrgtfiefr
ngmlnispigrsctleeriefseldkkekirekfvealktefagkglrfsrggmisfdvf
pegwdkrycldsldqdsfdtihffgnetspggndfeifadprtvghsvvspqdtvqrcre
iffpet

SCOPe Domain Coordinates for d2fuea_:

Click to download the PDB-style file with coordinates for d2fuea_.
(The format of our PDB-style files is described here.)

Timeline for d2fuea_: