SCOPe 2.08: Domain d2fudb_: 2fud B:

Lineage for d2fudb_ (2fud B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein automated matches [190264] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187102] (9 PDB entries)

8. Domain d2fudb_: 2fud B: [134118]
   automated match to d1ms6a_
   complexed with crl

Details for d2fudb_

PDB Entry: 2fud, 1.95 Å

PDB Description: Human Cathepsin S with Inhibitor CRA-27566

PDB Compounds: (B:) cathepsin S

SCOPe Domain Sequences for d2fudb_:

Sequence; same for both SEQRES and ATOM records:

>d2fudb_ d.3.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek
ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
lvknswghnfgeegyirmarnkgnhcgiasfpsypei

Timeline for d2fudb_:

• d2fudb_ first appeared in SCOP 1.73, called d2fudb1
  
• d2fudb_ appears in SCOPe 2.07