Lineage for d2fu9b_ (2fu9 B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1046299Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1046300Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1046301Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 1046302Protein Zn metallo-beta-lactamase [56283] (11 species)
  7. 1046391Species Xanthomonas maltophilia [TaxId:40324] [56286] (12 PDB entries)
  8. 1046393Domain d2fu9b_: 2fu9 B: [134113]
    automated match to d1smla_
    complexed with gol, mp2, so4, zn

Details for d2fu9b_

PDB Entry: 2fu9 (more details), 1.8 Å

PDB Description: Zinc-beta-lactamase L1 from stenotrophomonas maltophilia (mp2 inhibitor complex)
PDB Compounds: (B:) Metallo-beta-lactamase L1

SCOPe Domain Sequences for d2fu9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fu9b_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]}
evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas
hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd
lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria
yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga
kaltckayadaaeqkfdgqlaketag

SCOPe Domain Coordinates for d2fu9b_:

Click to download the PDB-style file with coordinates for d2fu9b_.
(The format of our PDB-style files is described here.)

Timeline for d2fu9b_: