SCOPe 2.01: Domain d2fu8a_: 2fu8 A:

Lineage for d2fu8a_ (2fu8 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein Zn metallo-beta-lactamase [56283] (11 species)

7. Species Xanthomonas maltophilia [TaxId:40324] [56286] (12 PDB entries)

8. Domain d2fu8a_: 2fu8 A: [134110]
   automated match to d1smla_
   complexed with gol, mco, so4, zn

Details for d2fu8a_

PDB Entry: 2fu8, 1.8 Å

PDB Description: Zinc-beta-lactamase L1 from stenotrophomonas maltophilia (d-captopril complex)

PDB Compounds: (A:) Metallo-beta-lactamase L1

SCOPe Domain Sequences for d2fu8a_:

Sequence; same for both SEQRES and ATOM records:

>d2fu8a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]}
evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas
hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd
lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria
yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga
kaltckayadaaeqkfdgqlaketag

Timeline for d2fu8a_:

• d2fu8a_ first appeared in SCOP 1.73, called d2fu8a1
  
• d2fu8a_ was called d2fu8a1 in SCOP 1.75
  
• d2fu8a_ appears in SCOPe 2.02
  
• d2fu8a_ appears in the current release, SCOPe 2.08