![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (11 families) ![]() |
![]() | Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein) |
![]() | Protein Zn metallo-beta-lactamase [56283] (8 species) |
![]() | Species Xanthomonas maltophilia [TaxId:40324] [56286] (11 PDB entries) |
![]() | Domain d2fu7b1: 2fu7 B:24-317 [134109] automatically matched to d1smla_ complexed with cu, gol, phn, so4 |
PDB Entry: 2fu7 (more details), 1.85 Å
SCOP Domain Sequences for d2fu7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fu7b1 d.157.1.1 (B:24-317) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]} evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga kaltckayadaaeqkfdgqlaketag
Timeline for d2fu7b1: