Lineage for d2fu7b1 (2fu7 B:24-317)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 736616Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 736617Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (11 families) (S)
  5. 736618Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein)
  6. 736619Protein Zn metallo-beta-lactamase [56283] (8 species)
  7. 736680Species Xanthomonas maltophilia [TaxId:40324] [56286] (11 PDB entries)
  8. 736693Domain d2fu7b1: 2fu7 B:24-317 [134109]
    automatically matched to d1smla_
    complexed with cu, gol, phn, so4

Details for d2fu7b1

PDB Entry: 2fu7 (more details), 1.85 Å

PDB Description: Zinc-beta-lactamase L1 from stenotrophomonas maltophilia (Cu-substituted form)
PDB Compounds: (B:) Metallo-beta-lactamase L1

SCOP Domain Sequences for d2fu7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fu7b1 d.157.1.1 (B:24-317) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]}
evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas
hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd
lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria
yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga
kaltckayadaaeqkfdgqlaketag

SCOP Domain Coordinates for d2fu7b1:

Click to download the PDB-style file with coordinates for d2fu7b1.
(The format of our PDB-style files is described here.)

Timeline for d2fu7b1: