SCOP 1.75: Domain d2fu7a1: 2fu7 A:24-317

Lineage for d2fu7a1 (2fu7 A:24-317)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (14 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein)

6. Protein Zn metallo-beta-lactamase [56283] (10 species)

7. Species Xanthomonas maltophilia [TaxId:40324] [56286] (12 PDB entries)

8. Domain d2fu7a1: 2fu7 A:24-317 [134108]
   automatically matched to d1smla_
   complexed with cu, gol, phn, so4

Details for d2fu7a1

PDB Entry: 2fu7, 1.85 Å

PDB Description: Zinc-beta-lactamase L1 from stenotrophomonas maltophilia (Cu-substituted form)

PDB Compounds: (A:) Metallo-beta-lactamase L1

SCOP Domain Sequences for d2fu7a1:

Sequence; same for both SEQRES and ATOM records:

>d2fu7a1 d.157.1.1 (A:24-317) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]}
evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas
hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd
lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria
yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga
kaltckayadaaeqkfdgqlaketag

Timeline for d2fu7a1:

• d2fu7a1 first appeared in SCOP 1.73
  
• d2fu7a1 is called d2fu7a_ in SCOPe 2.01
  
• d2fu7a1 appears in the current release, SCOPe 2.08, called d2fu7a_