Lineage for d2fu6a1 (2fu6 A:24-317)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 876590Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 876591Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (14 families) (S)
  5. 876592Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein)
  6. 876593Protein Zn metallo-beta-lactamase [56283] (10 species)
  7. 876661Species Xanthomonas maltophilia [TaxId:40324] [56286] (12 PDB entries)
  8. 876679Domain d2fu6a1: 2fu6 A:24-317 [134106]
    automatically matched to d1smla_
    complexed with gol, so4

Details for d2fu6a1

PDB Entry: 2fu6 (more details), 2.05 Å

PDB Description: Zinc-beta-lactamase l1 from stenotrophomonas maltophilia (apo form)
PDB Compounds: (A:) Metallo-beta-lactamase L1

SCOP Domain Sequences for d2fu6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fu6a1 d.157.1.1 (A:24-317) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]}
evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas
hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd
lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria
yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga
kaltckayadaaeqkfdgqlaketag

SCOP Domain Coordinates for d2fu6a1:

Click to download the PDB-style file with coordinates for d2fu6a1.
(The format of our PDB-style files is described here.)

Timeline for d2fu6a1: