SCOP 1.73: Domain d2fu6a1: 2fu6 A:24-317

Lineage for d2fu6a1 (2fu6 A:24-317)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (11 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein)

6. Protein Zn metallo-beta-lactamase [56283] (8 species)

7. Species Xanthomonas maltophilia [TaxId:40324] [56286] (11 PDB entries)

8. Domain d2fu6a1: 2fu6 A:24-317 [134106]
   automatically matched to d1smla_
   complexed with gol, so4

Details for d2fu6a1

PDB Entry: 2fu6, 2.05 Å

PDB Description: Zinc-beta-lactamase l1 from stenotrophomonas maltophilia (apo form)

PDB Compounds: (A:) Metallo-beta-lactamase L1

SCOP Domain Sequences for d2fu6a1:

Sequence; same for both SEQRES and ATOM records:

>d2fu6a1 d.157.1.1 (A:24-317) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]}
evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas
hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd
lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria
yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga
kaltckayadaaeqkfdgqlaketag

Timeline for d2fu6a1:

• d2fu6a1 is new in SCOP 1.73
  
• d2fu6a1 appears in SCOP 1.75
  
• d2fu6a1 appears in the current release, SCOPe 2.08, called d2fu6a_