![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (80 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Rab8a [142293] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [142294] (1 PDB entry) Uniprot P55258 3-175 |
![]() | Domain d2fu5c1: 2fu5 C:3-175 [134104] Other proteins in same PDB: d2fu5a1, d2fu5a2, d2fu5b2, d2fu5b3 complexed with bme, zn |
PDB Entry: 2fu5 (more details), 2 Å
SCOPe Domain Sequences for d2fu5c1:
Sequence, based on SEQRES records: (download)
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} ktydylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiw dtagqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnk cdvndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdk
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} ktydylfkllligdsgvtfistigidfkirtieldgkriklqiwdtttayyrgamgimlv yditneksfdnirnwirnieehasadvekmilgnkvndkrqvskergeklaldygikfme tsainvenafftlardikakmdk
Timeline for d2fu5c1: