Lineage for d2fu5c1 (2fu5 C:3-175)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846598Protein Rab8a [142293] (2 species)
  7. 1846614Species Mouse (Mus musculus) [TaxId:10090] [142294] (1 PDB entry)
    Uniprot P55258 3-175
  8. 1846615Domain d2fu5c1: 2fu5 C:3-175 [134104]
    Other proteins in same PDB: d2fu5a1, d2fu5b_
    complexed with bme, zn

Details for d2fu5c1

PDB Entry: 2fu5 (more details), 2 Å

PDB Description: structure of rab8 in complex with mss4
PDB Compounds: (C:) Ras-related protein Rab-8A

SCOPe Domain Sequences for d2fu5c1:

Sequence, based on SEQRES records: (download)

>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]}
ktydylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiw
dtagqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnk
cdvndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdk

Sequence, based on observed residues (ATOM records): (download)

>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]}
ktydylfkllligdsgvtfistigidfkirtieldgkriklqiwdtttayyrgamgimlv
yditneksfdnirnwirnieehasadvekmilgnkvndkrqvskergeklaldygikfme
tsainvenafftlardikakmdk

SCOPe Domain Coordinates for d2fu5c1:

Click to download the PDB-style file with coordinates for d2fu5c1.
(The format of our PDB-style files is described here.)

Timeline for d2fu5c1: