Lineage for d2fu5b_ (2fu5 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810140Fold b.88: Mss4-like [51315] (2 superfamilies)
    complex fold made of several coiled beta-sheets
  4. 1810141Superfamily b.88.1: Mss4-like [51316] (5 families) (S)
    duplication: tandem repeat of two similar structural motifs
  5. 1810142Family b.88.1.1: RabGEF Mss4 [51317] (1 protein)
    contains zinc-binding site
    automatically mapped to Pfam PF04421
  6. 1810143Protein RabGEF Mss4 [51318] (2 species)
  7. 1810144Species Human (Homo sapiens) [TaxId:9606] [51320] (2 PDB entries)
  8. 1810146Domain d2fu5b_: 2fu5 B: [134103]
    Other proteins in same PDB: d2fu5c1, d2fu5d_
    automated match to d1fwqa_
    complexed with bme, zn

Details for d2fu5b_

PDB Entry: 2fu5 (more details), 2 Å

PDB Description: structure of rab8 in complex with mss4
PDB Compounds: (B:) Guanine nucleotide exchange factor MSS4

SCOPe Domain Sequences for d2fu5b_:

Sequence, based on SEQRES records: (download)

>d2fu5b_ b.88.1.1 (B:) RabGEF Mss4 {Human (Homo sapiens) [TaxId: 9606]}
qghmvsaegrnrkavlcqrcgsrvlqpgtalfsrrqlflpsmrkkpalsdgsnpdgdllq
ehwlvedmfifenvgftkdvgnikflvcadceigpigwhclddknsfyvalervshe

Sequence, based on observed residues (ATOM records): (download)

>d2fu5b_ b.88.1.1 (B:) RabGEF Mss4 {Human (Homo sapiens) [TaxId: 9606]}
qghmvsaegrnrkavlcqrcgsrvlqpgtalfsrrqlflpsmrkdgdllqehwlvedmfi
fenvgftkdvgnikflvcadceigpigwhclddknsfyvalervshe

SCOPe Domain Coordinates for d2fu5b_:

Click to download the PDB-style file with coordinates for d2fu5b_.
(The format of our PDB-style files is described here.)

Timeline for d2fu5b_: