![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
![]() | Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families) ![]() |
![]() | Family c.57.1.2: MoeA central domain-like [64103] (2 proteins) |
![]() | Protein Gephyrin, domain 5 [110647] (1 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [110648] (3 PDB entries) |
![]() | Domain d2fu3b3: 2fu3 B:499-653 [134101] Other proteins in same PDB: d2fu3a1, d2fu3a2, d2fu3b1, d2fu3b2 automatically matched to d1t3ea3 |
PDB Entry: 2fu3 (more details), 2.7 Å
SCOP Domain Sequences for d2fu3b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fu3b3 c.57.1.2 (B:499-653) Gephyrin, domain 5 {Rat (Rattus norvegicus) [TaxId: 10116]} pvvavmstgnellnpeddllpgkirdsnrstllatiqehgyptinlgivgdnpddllnal negisradviitsggvsmgekdylkqvldidlhaqihfgrvfmkpglpttfatldidgvr kiifalpgnpvsavvtcnlfvvpalrkmqgildpr
Timeline for d2fu3b3: