Lineage for d2fu3b2 (2fu3 B:318-498)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430092Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
    complex fold made of bifurcated and coiled b-sheets
  4. 2430093Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) (S)
    automatically mapped to Pfam PF03453
  5. 2430094Family b.103.1.1: MoeA N-terminal region -like [63883] (3 proteins)
  6. 2430095Protein Gephyrin, domains 3 and 4 [110333] (1 species)
  7. 2430096Species Norway rat (Rattus norvegicus) [TaxId:10116] [110334] (3 PDB entries)
    Uniprot Q03555 350-768 # structure on the N-terminal domain (1-201) is also known (1ihc; (64101))
  8. 2430099Domain d2fu3b2: 2fu3 B:318-498 [134100]
    Other proteins in same PDB: d2fu3a1, d2fu3a3, d2fu3b1, d2fu3b3
    automated match to d2fu3b2

Details for d2fu3b2

PDB Entry: 2fu3 (more details), 2.7 Å

PDB Description: crystal structure of gephyrin e-domain
PDB Compounds: (B:) gephyrin

SCOPe Domain Sequences for d2fu3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fu3b2 b.103.1.1 (B:318-498) Gephyrin, domains 3 and 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgya
vraadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresd
dgteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnk
f

SCOPe Domain Coordinates for d2fu3b2:

Click to download the PDB-style file with coordinates for d2fu3b2.
(The format of our PDB-style files is described here.)

Timeline for d2fu3b2: