Class b: All beta proteins [48724] (177 folds) |
Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily) complex fold made of bifurcated and coiled b-sheets |
Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) automatically mapped to Pfam PF03453 |
Family b.103.1.1: MoeA N-terminal region -like [63883] (3 proteins) |
Protein Gephyrin, domains 3 and 4 [110333] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [110334] (3 PDB entries) Uniprot Q03555 350-768 # structure on the N-terminal domain (1-201) is also known (1ihc; (64101)) |
Domain d2fu3b2: 2fu3 B:318-498 [134100] Other proteins in same PDB: d2fu3a1, d2fu3a3, d2fu3b1, d2fu3b3 automated match to d2fu3b2 |
PDB Entry: 2fu3 (more details), 2.7 Å
SCOPe Domain Sequences for d2fu3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fu3b2 b.103.1.1 (B:318-498) Gephyrin, domains 3 and 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgya vraadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresd dgteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnk f
Timeline for d2fu3b2: