SCOP 1.75: Domain d2fu3a2: 2fu3 A:318-498

Lineage for d2fu3a2 (2fu3 A:318-498)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
   complex fold made of bifurcated and coiled b-sheets

4. Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family)

5. Family b.103.1.1: MoeA N-terminal region -like [63883] (2 proteins)

6. Protein Gephyrin, domains 3 and 4 [110333] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [110334] (3 PDB entries)
   Uniprot Q03555 350-768 # structure on the N-terminal domain (1-201) is also known (1ihc; (64101))

8. Domain d2fu3a2: 2fu3 A:318-498 [134097]
   Other proteins in same PDB: d2fu3a1, d2fu3a3, d2fu3b1, d2fu3b3
   automatically matched to d1t3ea2

Details for d2fu3a2

PDB Entry: 2fu3, 2.7 Å

PDB Description: crystal structure of gephyrin e-domain

PDB Compounds: (A:) gephyrin

SCOP Domain Sequences for d2fu3a2:

Sequence, based on SEQRES records:

>d2fu3a2 b.103.1.1 (A:318-498) Gephyrin, domains 3 and 4 {Rat (Rattus norvegicus) [TaxId: 10116]}
mspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgya
vraadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresd
dgteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnk
f

Sequence, based on observed residues (ATOM records):

>d2fu3a2 b.103.1.1 (A:318-498) Gephyrin, domains 3 and 4 {Rat (Rattus norvegicus) [TaxId: 10116]}
mspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgya
vraadgpgdrfiigtvmpgqvmrvttgapipcgadavvqvedtelireseelevrilvqa
rpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnkf

Timeline for d2fu3a2:

• d2fu3a2 first appeared in SCOP 1.73
  
• d2fu3a2 appears in SCOPe 2.01
  
• d2fu3a2 appears in the current release, SCOPe 2.08