Lineage for d2fu3a2 (2fu3 A:318-498)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 679239Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
    complex fold made of bifurcated and coiled b-sheets
  4. 679240Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) (S)
  5. 679241Family b.103.1.1: MoeA N-terminal region -like [63883] (2 proteins)
  6. 679242Protein Gephyrin, domains 3 and 4 [110333] (1 species)
  7. 679243Species Rat (Rattus norvegicus) [TaxId:10116] [110334] (3 PDB entries)
  8. 679245Domain d2fu3a2: 2fu3 A:318-498 [134097]
    Other proteins in same PDB: d2fu3a1, d2fu3a3, d2fu3b1, d2fu3b3
    automatically matched to d1t3ea2

Details for d2fu3a2

PDB Entry: 2fu3 (more details), 2.7 Å

PDB Description: crystal structure of gephyrin e-domain
PDB Compounds: (A:) gephyrin

SCOP Domain Sequences for d2fu3a2:

Sequence, based on SEQRES records: (download)

>d2fu3a2 b.103.1.1 (A:318-498) Gephyrin, domains 3 and 4 {Rat (Rattus norvegicus) [TaxId: 10116]}
mspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgya
vraadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresd
dgteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnk
f

Sequence, based on observed residues (ATOM records): (download)

>d2fu3a2 b.103.1.1 (A:318-498) Gephyrin, domains 3 and 4 {Rat (Rattus norvegicus) [TaxId: 10116]}
mspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgya
vraadgpgdrfiigtvmpgqvmrvttgapipcgadavvqvedtelireseelevrilvqa
rpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnkf

SCOP Domain Coordinates for d2fu3a2:

Click to download the PDB-style file with coordinates for d2fu3a2.
(The format of our PDB-style files is described here.)

Timeline for d2fu3a2: