Lineage for d2fu3a1 (2fu3 A:654-736)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 811032Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 811267Superfamily b.85.6: MoeA C-terminal domain-like [63867] (1 family) (S)
  5. 811268Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins)
  6. 811269Protein Gephyrin, C-terminal domain [110330] (1 species)
  7. 811270Species Rat (Rattus norvegicus) [TaxId:10116] [110331] (3 PDB entries)
    Uniprot Q03555 350-768 # structure on the N-terminal domain (1-201) is also known (1ihc; (64101))
  8. 811272Domain d2fu3a1: 2fu3 A:654-736 [134096]
    Other proteins in same PDB: d2fu3a2, d2fu3a3, d2fu3b2, d2fu3b3
    automatically matched to d1t3ea1

Details for d2fu3a1

PDB Entry: 2fu3 (more details), 2.7 Å

PDB Description: crystal structure of gephyrin e-domain
PDB Compounds: (A:) gephyrin

SCOP Domain Sequences for d2fu3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fu3a1 b.85.6.1 (A:654-736) Gephyrin, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}
ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstgnqmssrlmsmrsangllmlp
pkteqyvelhkgevvdvmvigrl

SCOP Domain Coordinates for d2fu3a1:

Click to download the PDB-style file with coordinates for d2fu3a1.
(The format of our PDB-style files is described here.)

Timeline for d2fu3a1: