![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.6: MoeA C-terminal domain-like [63867] (1 family) ![]() |
![]() | Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins) |
![]() | Protein Gephyrin, C-terminal domain [110330] (1 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [110331] (3 PDB entries) |
![]() | Domain d2fu3a1: 2fu3 A:654-736 [134096] Other proteins in same PDB: d2fu3a2, d2fu3a3, d2fu3b2, d2fu3b3 automatically matched to d1t3ea1 |
PDB Entry: 2fu3 (more details), 2.7 Å
SCOP Domain Sequences for d2fu3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fu3a1 b.85.6.1 (A:654-736) Gephyrin, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstgnqmssrlmsmrsangllmlp pkteqyvelhkgevvdvmvigrl
Timeline for d2fu3a1: