Class b: All beta proteins [48724] (180 folds) |
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) this domain is interrupted by the catalytic beta/alpha barrel domain |
Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (5 proteins) |
Protein Dihydropyrimidine amidohydrolase Pyd2 [141683] (2 species) |
Species Yeast (Saccharomyces kluyveri) [TaxId:4934] [141684] (3 PDB entries) Uniprot Q9P903 2-56,441-541 |
Domain d2ftyd1: 2fty D:2-56,D:441-541 [134093] Other proteins in same PDB: d2ftya2, d2ftyb2, d2ftyc2, d2ftyd2 automated match to d2ftya1 complexed with zn |
PDB Entry: 2fty (more details), 2.4 Å
SCOPe Domain Sequences for d2ftyd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ftyd1 b.92.1.3 (D:2-56,D:441-541) Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Saccharomyces kluyveri) [TaxId: 4934]} piydliikngiictasdiyaaeiavnngkvqliaasidpslgsevidaegafitpXilpg vsdadlviwypddskkeynskpklitnklmehncdytpfegieiknwprytivkgkivyk egeilkenadgkylkrgksfmctpknewvtewrpkye
Timeline for d2ftyd1: