SCOPe 2.08: Domain d2ftxb1: 2ftx B:155-213

Lineage for d2ftxb1 (2ftx B:155-213)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.300: Kinetochore globular domain-like [143025] (1 superfamily)
   core: alpha-beta(3)-alpha; variant: alpha-beta(4)-alpha(2)

4. Superfamily d.300.1: Kinetochore globular domain [143026] (2 families)
   swapped heterodimer with the N-terminal helices; Spc24-like subunits have the core fold, whereas Spc25-like subunits have a variant fold

5. Family d.300.1.2: Spc24-like [143030] (1 protein)
   Pfam PF08286

6. Protein Kinetochore protein Spc24 [143031] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143032] (2 PDB entries)
   Uniprot Q04477 155-213! Uniprot Q04477 156-213

8. Domain d2ftxb1: 2ftx B:155-213 [134086]
   Other proteins in same PDB: d2ftxa1
   complexed with na, po4

Details for d2ftxb1

PDB Entry: 2ftx, 1.9 Å

PDB Description: Crystal structure of the yeast kinetochore Spc24/Spc25 globular domain

PDB Compounds: (B:) Hypothetical 24.6 kDa protein in ILV2-ADE17 intergenic region

SCOPe Domain Sequences for d2ftxb1:

Sequence; same for both SEQRES and ATOM records:

>d2ftxb1 d.300.1.2 (B:155-213) Kinetochore protein Spc24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
anenilklklyrslgvildlendqvlinrkndgnidilpldnnlsdfyktkyiwerlgk

Timeline for d2ftxb1:

• d2ftxb1 first appeared in SCOP 1.73
  
• d2ftxb1 appears in SCOPe 2.07