Class b: All beta proteins [48724] (174 folds) |
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families) this domain is interrupted by the catalytic beta/alpha barrel domain |
Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (5 proteins) |
Protein Dihydropyrimidine amidohydrolase Pyd2 [141683] (2 species) |
Species Dictyostelium discoideum [TaxId:44689] [141685] (1 PDB entry) Uniprot Q86LT2 7-59,394-490 |
Domain d2ftwa1: 2ftw A:7-59,A:394-490 [134083] Other proteins in same PDB: d2ftwa2 complexed with mli, zn |
PDB Entry: 2ftw (more details), 2.05 Å
SCOP Domain Sequences for d2ftwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ftwa1 b.92.1.3 (A:7-59,A:394-490) Dihydropyrimidine amidohydrolase Pyd2 {Dictyostelium discoideum [TaxId: 44689]} tgtilikngtvvnddryfksdvlvengiikeiskniepkegikvvdatdklllXidvgcd gdiviwdpnqsktiskdthhhavdfnifegikvtgiavttivagnivwsdnklscvkgsg rfvprppfgpvfdgieqrdkvrnellrkvdr
Timeline for d2ftwa1: