Class a: All alpha proteins [46456] (290 folds) |
Fold a.13: RAP domain-like [47044] (1 superfamily) 3 helices, the first one is shorter than the other two; bundle, partly opened |
Superfamily a.13.1: RAP domain-like [47045] (1 family) |
Family a.13.1.1: RAP domain [47046] (1 protein) |
Protein alpha-2-Macroglobulin receptor associated protein (RAP) [47047] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47048] (7 PDB entries) |
Domain d2ftua1: 2ftu A:1-118 [134082] 3rd RAP domain |
PDB Entry: 2ftu (more details)
SCOPe Domain Sequences for d2ftua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ftua1 a.13.1.1 (A:1-118) alpha-2-Macroglobulin receptor associated protein (RAP) {Human (Homo sapiens) [TaxId: 9606]} rvshqgysteaefeeprvidlwdlaqsanltdkeleafreelkhfeakiekhnhyqkqle iaheklrhaesvgdgervsrsrekhallegrtkelgytvkkhlqdlsgrisrarhnel
Timeline for d2ftua1: