Lineage for d2ftua1 (2ftu A:1-118)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697661Fold a.13: RAP domain-like [47044] (1 superfamily)
    3 helices, the first one is shorter than the other two; bundle, partly opened
  4. 2697662Superfamily a.13.1: RAP domain-like [47045] (1 family) (S)
  5. 2697663Family a.13.1.1: RAP domain [47046] (1 protein)
  6. 2697664Protein alpha-2-Macroglobulin receptor associated protein (RAP) [47047] (1 species)
  7. 2697665Species Human (Homo sapiens) [TaxId:9606] [47048] (7 PDB entries)
  8. 2697670Domain d2ftua1: 2ftu A:1-118 [134082]
    3rd RAP domain

Details for d2ftua1

PDB Entry: 2ftu (more details)

PDB Description: solution structure of domain 3 of rap
PDB Compounds: (A:) Alpha-2-macroglobulin receptor-associated protein, domain 3

SCOPe Domain Sequences for d2ftua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ftua1 a.13.1.1 (A:1-118) alpha-2-Macroglobulin receptor associated protein (RAP) {Human (Homo sapiens) [TaxId: 9606]}
rvshqgysteaefeeprvidlwdlaqsanltdkeleafreelkhfeakiekhnhyqkqle
iaheklrhaesvgdgervsrsrekhallegrtkelgytvkkhlqdlsgrisrarhnel

SCOPe Domain Coordinates for d2ftua1:

Click to download the PDB-style file with coordinates for d2ftua1.
(The format of our PDB-style files is described here.)

Timeline for d2ftua1: