SCOP 1.73: Domain d2ftsa3: 2fts A:499-653

Lineage for d2ftsa3 (2fts A:499-653)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families)

5. Family c.57.1.2: MoeA central domain-like [64103] (2 proteins)

6. Protein Gephyrin, domain 5 [110647] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [110648] (3 PDB entries)

8. Domain d2ftsa3: 2fts A:499-653 [134081]
   Other proteins in same PDB: d2ftsa1, d2ftsa2
   automatically matched to d1t3ea3

Details for d2ftsa3

PDB Entry: 2fts, 2.41 Å

PDB Description: crystal structure of the glycine receptor-gephyrin complex

PDB Compounds: (A:) gephyrin

SCOP Domain Sequences for d2ftsa3:

Sequence; same for both SEQRES and ATOM records:

>d2ftsa3 c.57.1.2 (A:499-653) Gephyrin, domain 5 {Rat (Rattus norvegicus) [TaxId: 10116]}
pvvavmstgnellnpeddllpgkirdsnrstllatiqehgyptinlgivgdnpddllnal
negisradviitsggvsmgekdylkqvldidlhaqihfgrvfmkpglpttfatldidgvr
kiifalpgnpvsavvtcnlfvvpalrkmqgildpr

Timeline for d2ftsa3:

• d2ftsa3 is new in SCOP 1.73
  
• d2ftsa3 appears in SCOP 1.75
  
• d2ftsa3 appears in the current release, SCOPe 2.08