![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
![]() | Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families) ![]() |
![]() | Family c.57.1.2: MoeA central domain-like [64103] (2 proteins) |
![]() | Protein Gephyrin, domain 5 [110647] (1 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [110648] (3 PDB entries) |
![]() | Domain d2ftsa3: 2fts A:499-653 [134081] Other proteins in same PDB: d2ftsa1, d2ftsa2 automatically matched to d1t3ea3 |
PDB Entry: 2fts (more details), 2.41 Å
SCOP Domain Sequences for d2ftsa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ftsa3 c.57.1.2 (A:499-653) Gephyrin, domain 5 {Rat (Rattus norvegicus) [TaxId: 10116]} pvvavmstgnellnpeddllpgkirdsnrstllatiqehgyptinlgivgdnpddllnal negisradviitsggvsmgekdylkqvldidlhaqihfgrvfmkpglpttfatldidgvr kiifalpgnpvsavvtcnlfvvpalrkmqgildpr
Timeline for d2ftsa3: