Lineage for d2ftsa2 (2fts A:318-498)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2085723Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
    complex fold made of bifurcated and coiled b-sheets
  4. 2085724Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) (S)
    automatically mapped to Pfam PF03453
  5. 2085725Family b.103.1.1: MoeA N-terminal region -like [63883] (3 proteins)
  6. 2085726Protein Gephyrin, domains 3 and 4 [110333] (1 species)
  7. 2085727Species Norway rat (Rattus norvegicus) [TaxId:10116] [110334] (3 PDB entries)
    Uniprot Q03555 350-768 # structure on the N-terminal domain (1-201) is also known (1ihc; (64101))
  8. 2085728Domain d2ftsa2: 2fts A:318-498 [134080]
    Other proteins in same PDB: d2ftsa1, d2ftsa3
    automated match to d2ftsa2

Details for d2ftsa2

PDB Entry: 2fts (more details), 2.41 Å

PDB Description: crystal structure of the glycine receptor-gephyrin complex
PDB Compounds: (A:) gephyrin

SCOPe Domain Sequences for d2ftsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ftsa2 b.103.1.1 (A:318-498) Gephyrin, domains 3 and 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgya
vraadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresd
dgteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnk
f

SCOPe Domain Coordinates for d2ftsa2:

Click to download the PDB-style file with coordinates for d2ftsa2.
(The format of our PDB-style files is described here.)

Timeline for d2ftsa2: