SCOP 1.75: Domain d2ftsa2: 2fts A:318-498

Lineage for d2ftsa2 (2fts A:318-498)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
   complex fold made of bifurcated and coiled b-sheets

4. Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family)

5. Family b.103.1.1: MoeA N-terminal region -like [63883] (2 proteins)

6. Protein Gephyrin, domains 3 and 4 [110333] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [110334] (3 PDB entries)
   Uniprot Q03555 350-768 # structure on the N-terminal domain (1-201) is also known (1ihc; (64101))

8. Domain d2ftsa2: 2fts A:318-498 [134080]
   Other proteins in same PDB: d2ftsa1, d2ftsa3
   automatically matched to d1t3ea2

Details for d2ftsa2

PDB Entry: 2fts, 2.41 Å

PDB Description: crystal structure of the glycine receptor-gephyrin complex

PDB Compounds: (A:) gephyrin

SCOP Domain Sequences for d2ftsa2:

Sequence; same for both SEQRES and ATOM records:

>d2ftsa2 b.103.1.1 (A:318-498) Gephyrin, domains 3 and 4 {Rat (Rattus norvegicus) [TaxId: 10116]}
mspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgya
vraadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresd
dgteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnk
f

Timeline for d2ftsa2:

• d2ftsa2 first appeared in SCOP 1.73
  
• d2ftsa2 appears in SCOPe 2.01
  
• d2ftsa2 appears in the current release, SCOPe 2.08