SCOPe 2.06: Domain d2ftsa1: 2fts A:654-736

Lineage for d2ftsa1 (2fts A:654-736)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families)
   automatically mapped to Pfam PF03454

5. Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins)

6. Protein Gephyrin, C-terminal domain [110330] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [110331] (3 PDB entries)
   Uniprot Q03555 350-768 # structure on the N-terminal domain (1-201) is also known (1ihc; (64101))

8. Domain d2ftsa1: 2fts A:654-736 [134079]
   Other proteins in same PDB: d2ftsa2, d2ftsa3
   automated match to d2ftsa1

Details for d2ftsa1

PDB Entry: 2fts, 2.41 Å

PDB Description: crystal structure of the glycine receptor-gephyrin complex

PDB Compounds: (A:) gephyrin

SCOPe Domain Sequences for d2ftsa1:

Sequence; same for both SEQRES and ATOM records:

>d2ftsa1 b.85.6.1 (A:654-736) Gephyrin, C-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstgnqmssrlmsmrsangllmlp
pkteqyvelhkgevvdvmvigrl

Timeline for d2ftsa1:

• d2ftsa1 first appeared in SCOP 1.73
  
• d2ftsa1 appears in SCOPe 2.05
  
• d2ftsa1 appears in SCOPe 2.07
  
• d2ftsa1 appears in the current release, SCOPe 2.08