Lineage for d2ftsa1 (2fts A:654-736)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 678386Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 678607Superfamily b.85.6: MoeA C-terminal domain-like [63867] (1 family) (S)
  5. 678608Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins)
  6. 678609Protein Gephyrin, C-terminal domain [110330] (1 species)
  7. 678610Species Rat (Rattus norvegicus) [TaxId:10116] [110331] (3 PDB entries)
  8. 678611Domain d2ftsa1: 2fts A:654-736 [134079]
    Other proteins in same PDB: d2ftsa2, d2ftsa3
    automatically matched to d1t3ea1

Details for d2ftsa1

PDB Entry: 2fts (more details), 2.41 Å

PDB Description: crystal structure of the glycine receptor-gephyrin complex
PDB Compounds: (A:) gephyrin

SCOP Domain Sequences for d2ftsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ftsa1 b.85.6.1 (A:654-736) Gephyrin, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}
ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstgnqmssrlmsmrsangllmlp
pkteqyvelhkgevvdvmvigrl

SCOP Domain Coordinates for d2ftsa1:

Click to download the PDB-style file with coordinates for d2ftsa1.
(The format of our PDB-style files is described here.)

Timeline for d2ftsa1: