Class b: All beta proteins [48724] (165 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.6: MoeA C-terminal domain-like [63867] (1 family) |
Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins) |
Protein Gephyrin, C-terminal domain [110330] (1 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [110331] (3 PDB entries) |
Domain d2ftsa1: 2fts A:654-736 [134079] Other proteins in same PDB: d2ftsa2, d2ftsa3 automatically matched to d1t3ea1 |
PDB Entry: 2fts (more details), 2.41 Å
SCOP Domain Sequences for d2ftsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ftsa1 b.85.6.1 (A:654-736) Gephyrin, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstgnqmssrlmsmrsangllmlp pkteqyvelhkgevvdvmvigrl
Timeline for d2ftsa1: