SCOP 1.73: Domain d2ftrb1: 2ftr B:6-105

Lineage for d2ftrb1 (2ftr B:6-105)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (17 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.15: EthD-like [143272] (1 protein)
   Pfam PF07110

6. Protein Hypothetical protein BH0200 [143273] (1 species)

7. Species Bacillus halodurans [TaxId:86665] [143274] (1 PDB entry)

8. Domain d2ftrb1: 2ftr B:6-105 [134078]
   automatically matched to 2FTR A:4-106
   complexed with cl, gol, unl

Details for d2ftrb1

PDB Entry: 2ftr, 1.4 Å

PDB Description: Crystal structure of an ethyl tert-butyl ether d (ethd) family protein (bh0200) from bacillus halodurans c-125 at 1.40 A resolution

PDB Compounds: (B:) bh0200

SCOP Domain Sequences for d2ftrb1:

Sequence; same for both SEQRES and ATOM records:

>d2ftrb1 d.58.4.15 (B:6-105) Hypothetical protein BH0200 {Bacillus halodurans [TaxId: 86665]}
mmvklialyeqpedkqafdehyfnthapltrkipglrdmkvtrivgspmgeskfylmcem
yyddheslqqamrtdegkasgkdamkfagklltlmigeem

Timeline for d2ftrb1:

• d2ftrb1 is new in SCOP 1.73
  
• d2ftrb1 appears in SCOP 1.75
  
• d2ftrb1 appears in the current release, SCOPe 2.08, called d2ftrb_