Lineage for d2ftra1 (2ftr A:4-106)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. Family d.58.4.15: EthD-like [143272] (1 protein)
    Pfam PF07110
  6. Protein Hypothetical protein BH0200 [143273] (1 species)
  7. Species Bacillus halodurans [TaxId:86665] [143274] (1 PDB entry)
    Uniprot Q9KGB0 4-106
  8. Domain d2ftra1: 2ftr A:4-106 [134077]
    complexed with cl, gol, unl

Details for d2ftra1

PDB Entry: 2ftr (more details), 1.4 Å

PDB Description: Crystal structure of an ethyl tert-butyl ether d (ethd) family protein (bh0200) from bacillus halodurans c-125 at 1.40 A resolution
PDB Compounds: (A:) bh0200

SCOPe Domain Sequences for d2ftra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ftra1 d.58.4.15 (A:4-106) Hypothetical protein BH0200 {Bacillus halodurans [TaxId: 86665]}
enmmvklialyeqpedkqafdehyfnthapltrkipglrdmkvtrivgspmgeskfylmc
emyyddheslqqamrtdegkasgkdamkfagklltlmigeemd

SCOPe Domain Coordinates for d2ftra1 are not available.

Timeline for d2ftra1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ftrb_