Lineage for d2ftmb1 (2ftm B:1-58)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 748504Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 748505Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 748506Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (12 proteins)
  6. 748544Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
  7. 748545Species Cow (Bos taurus) [TaxId:9913] [57365] (75 PDB entries)
  8. 748567Domain d2ftmb1: 2ftm B:1-58 [134075]
    automatically matched to d8pti__
    complexed with ca, edo, ias, na, so4; mutant

Details for d2ftmb1

PDB Entry: 2ftm (more details), 1.65 Å

PDB Description: crystal structure of trypsin complexed with the bpti variant (tyr35- >gly)
PDB Compounds: (B:) pancreatic trypsin inhibitor

SCOP Domain Sequences for d2ftmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ftmb1 g.8.1.1 (B:1-58) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppytgpckariiryfynakaglcqtfvgggcrakrnnfksaedcmrtcgga

SCOP Domain Coordinates for d2ftmb1:

Click to download the PDB-style file with coordinates for d2ftmb1.
(The format of our PDB-style files is described here.)

Timeline for d2ftmb1: