Lineage for d2ftkf1 (2ftk F:1003-1121)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 825506Superfamily c.23.1: CheY-like [52172] (7 families) (S)
  5. 825507Family c.23.1.1: CheY-related [52173] (25 proteins)
  6. 825716Protein Sporulation response regulator Spo0F [52188] (1 species)
  7. 825717Species Bacillus subtilis [TaxId:1423] [52189] (8 PDB entries)
    Uniprot P06628
  8. 825723Domain d2ftkf1: 2ftk F:1003-1121 [134070]
    Other proteins in same PDB: d2ftka1, d2ftkb1, d2ftkc1, d2ftkd1
    automatically matched to d1srrc_
    complexed with bfd, mg; mutant

Details for d2ftkf1

PDB Entry: 2ftk (more details), 3.05 Å

PDB Description: berylloflouride spo0f complex with spo0b
PDB Compounds: (F:) sporulation initiation phosphotransferase f

SCOP Domain Sequences for d2ftkf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ftkf1 c.23.1.1 (F:1003-1121) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]}
nekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg
ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl

SCOP Domain Coordinates for d2ftkf1:

Click to download the PDB-style file with coordinates for d2ftkf1.
(The format of our PDB-style files is described here.)

Timeline for d2ftkf1: