![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
![]() | Family c.23.1.1: CheY-related [52173] (26 proteins) |
![]() | Protein Sporulation response regulator Spo0F [52188] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [52189] (12 PDB entries) Uniprot P06628 |
![]() | Domain d2ftke_: 2ftk E: [134069] Other proteins in same PDB: d2ftka_, d2ftkb_, d2ftkc_, d2ftkd_ automated match to d2fspa_ complexed with mg |
PDB Entry: 2ftk (more details), 3.05 Å
SCOPe Domain Sequences for d2ftke_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ftke_ c.23.1.1 (E:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} nekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl
Timeline for d2ftke_: