Lineage for d2ftke_ (2ftk E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855425Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2855650Protein Sporulation response regulator Spo0F [52188] (1 species)
  7. 2855651Species Bacillus subtilis [TaxId:1423] [52189] (12 PDB entries)
    Uniprot P06628
  8. 2855658Domain d2ftke_: 2ftk E: [134069]
    Other proteins in same PDB: d2ftka_, d2ftkb_, d2ftkc_, d2ftkd_
    automated match to d2fspa_
    complexed with mg

Details for d2ftke_

PDB Entry: 2ftk (more details), 3.05 Å

PDB Description: berylloflouride spo0f complex with spo0b
PDB Compounds: (E:) sporulation initiation phosphotransferase f

SCOPe Domain Sequences for d2ftke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ftke_ c.23.1.1 (E:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]}
nekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg
ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl

SCOPe Domain Coordinates for d2ftke_:

Click to download the PDB-style file with coordinates for d2ftke_.
(The format of our PDB-style files is described here.)

Timeline for d2ftke_: